CASS4 Rabbit Polyclonal Antibody
CAT#: TA344794
Rabbit Polyclonal Anti-CASS4 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CASS4 antibody is: synthetic peptide directed towards the N-terminal region of Human CASS4. Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | Cas scaffolding protein family member 4 |
Database Link | |
Background | CASS4 is a docking protein that plays a role in tyrosine kinase-based signaling related to cell adhesion and cell spreading. It regulates PTK2/FAK1 activity, focal adhesion integrity, and cell spreading. |
Synonyms | C20orf32; CAS4; HEFL; HEPL |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 91% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |