TDP1 Rabbit Polyclonal Antibody

CAT#: TA344882

Rabbit Polyclonal Anti-TDP1 Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Tdp1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 64 kDa
Gene Name tyrosyl-DNA phosphodiesterase 1
Background Tdp1 is a DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. It catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. It hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. It acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. It has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. It has no exonuclease activity towards DNA or RNA with a 3'phosphate.
Synonyms FLJ11090; MGC104252
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Bovine: 92%; Mouse: 86%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...