TDP1 (NM_001008744) Human Recombinant Protein
CAT#: TP301888
Recombinant protein of human tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 2, 20 µg
View other "TDP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201888 protein sequence
Red=Cloning site Green=Tags(s) MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDS VLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKE EEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDW LVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIH TSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSET NVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESM LTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNA MPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFF AGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 68.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008744 |
Locus ID | 55775 |
UniProt ID | Q9NUW8 |
Refseq Size | 3540 |
Cytogenetics | 14q32.11 |
Refseq ORF | 1824 |
Summary | The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1). [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413162 | TDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423370 | TDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413162 | Transient overexpression lysate of tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 1 |
CNY 3080.00 |
|
LY423370 | Transient overexpression lysate of tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 2 |
CNY 3080.00 |
|
PH301888 | TDP1 MS Standard C13 and N15-labeled recombinant protein (NP_001008744) |
CNY 19520.00 |
|
PH314927 | TDP1 MS Standard C13 and N15-labeled recombinant protein (NP_060789) |
CNY 19520.00 |
|
TP314927 | Recombinant protein of human tyrosyl-DNA phosphodiesterase 1 (TDP1), transcript variant 1, 20 µg |
CNY 2900.00 |