VPS53 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-VPS53 antibody: synthetic peptide directed towards the middle region of human VPS53. Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	92 kDa
Gene Name	VPS53, GARP complex subunit
Database Link	NP_001121631 Entrez Gene 55275 Human UniProt ID Q5VIR6
Background	This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.
Synonyms	HCCS1; hVps53L; PCH2E; pp13624
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.