ERCC6L Rabbit Polyclonal Antibody
CAT#: TA344980
Rabbit Polyclonal Anti-ERCC6L Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ERCC6L antibody: synthetic peptide directed towards the N terminal of human ERCC6L. Synthetic peptide located within the following region: GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 141 kDa |
| Gene Name | ERCC excision repair 6 like, spindle assembly checkpoint helicase |
| Database Link | |
| Background | ERCC6L is a DNA helicase that acts as an essential component of the spindle assembly checkpoint.ERCC6L contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. ERCC6L acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase. |
| Synonyms | PICH; RAD26L |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Rat: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
