FAM29A (HAUS6) Rabbit Polyclonal Antibody
CAT#: TA344982
Rabbit Polyclonal Anti-FAM29A Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FAM29A antibody: synthetic peptide directed towards the middle region of human FAM29A. Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 108 kDa |
Gene Name | HAUS augmin like complex subunit 6 |
Database Link | |
Background | FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin. |
Synonyms | Dgt6; FAM29A |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Horse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |