Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody

CAT#: TA345107

Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E5, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E6
    • 100 ug

CNY 3080.00


Recombinant protein of human acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E5, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of acetylcholinesterase (Yt blood group) (ACHE), transcript variant E4-E5
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution IHC, WB, IF
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 61 kDa
Gene Name acetylcholinesterase (Cartwright blood group)
Background This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. [provided by RefSeq, Jul 2008]
Synonyms ACEE; ARACHE; N-ACHE; YT
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 91%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Glycerophospholipid metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...