RP2 Rabbit Polyclonal Antibody
CAT#: TA345130
Rabbit Polyclonal Anti-RP2 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RP2 antibody: synthetic peptide directed towards the middle region of human RP2. Synthetic peptide located within the following region: LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | retinitis pigmentosa 2 (X-linked recessive) |
Database Link | |
Background | The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death [provided by RefSeq, Jul 2008]. |
Synonyms | DELXp11.3; NM23-H10; NME10; TBCCD2; XRP2 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |