Septin 2 (SEPT2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Monkey, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	septin 2
Database Link	NP_006146 Entrez Gene 18000 MouseEntrez Gene 4735 Human UniProt ID Q15019
Background	SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.
Synonyms	DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 90%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.