NFAT2 (NFATC1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF83 antibody: synthetic peptide directed towards the N terminal of human ZNF83. Synthetic peptide located within the following region: MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	nuclear factor of activated T-cells 1
Database Link	NP_006153 Entrez Gene 4772 Human UniProt ID O95644
Background	ZNF83 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers. ZNF83 may be involved in transcriptional regulation.
Synonyms	NF-ATC; NF-ATc1.2; NFAT2; NFATc
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Axon guidance, B cell receptor signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.