ZNF444 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF444 antibody: synthetic peptide directed towards the C terminal of human ZNF444. Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	zinc finger protein 444
Database Link	NP_060807 Entrez Gene 55311 Human UniProt ID Q8N0Y2
Background	ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, which strongly suggested that ZNF444 is a transcriptional regulator.ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534). [supplied by OMIM]
Synonyms	EZF-2; EZF2; ZSCAN17
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.