KLHL8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLHL8 antibody: synthetic peptide directed towards the N terminal of human KLHL8. Synthetic peptide located within the following region: MASDSMSSKQARNHITKGKRQQQHQQIKNRSSISDGDGEDSFIFEANEAW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	kelch like family member 8
Database Link	NP_065854 Entrez Gene 57563 Human UniProt ID Q9P2G9
Background	The specific function of KLHL8 is not yet known.
Synonyms	FLJ46304; KIAA1378
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rabbit: 86%; Rat: 82%; Horse: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.