ZNF257 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF257 antibody: synthetic peptide directed towards the C terminal of human ZNF257. Synthetic peptide located within the following region: HLSQHKIIHTGEKPYKCEECGKPFNRFSYLTVHKRIHAGENPNKYEECGK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	zinc finger protein 257
Database Link	NP_258429 Entrez Gene 113835 Human UniProt ID Q9Y2Q1
Background	The function of ZNF257 has not yet been determined.
Synonyms	BMZF-4; BMZF4
Note	Immunogen Sequence Homology: Human: 100%; Dog: 90%; Horse: 77%; Mouse: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.