TRIOBP Rabbit Polyclonal Antibody
CAT#: TA345504
Rabbit Polyclonal Anti-TRIOBP Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRIOBP antibody: synthetic peptide directed towards the middle region of human TRIOBP. Synthetic peptide located within the following region: VQALRAQLEAWRLQGEAPQSALRSQEDGHIPPGYISQLVGVITVPVLQTR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | TRIO and F-actin binding protein |
Database Link | |
Background | TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cel |
Synonyms | DFNB28; dJ37E16.4; HRIHFB2122; TAP68; TARA |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |