TRIOBP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRIOBP antibody: synthetic peptide directed towards the middle region of human TRIOBP. Synthetic peptide located within the following region: VQALRAQLEAWRLQGEAPQSALRSQEDGHIPPGYISQLVGVITVPVLQTR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	TRIO and F-actin binding protein
Database Link	NP_619538 Entrez Gene 11078 Human UniProt ID Q9H2D6
Background	TRIOBP is a protein with an N-terminal pleckstrin homology domain and a C-terminal coiled-coil region. The protein interacts with trio, which is involved with neural tissue development and controlling actin cytoskeleton organization, cell motility and cel
Synonyms	DFNB28; dJ37E16.4; HRIHFB2122; TAP68; TARA
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.