ZUP1 Rabbit Polyclonal Antibody
CAT#: TA345514
Rabbit Polyclonal Anti-C6orf113 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-C6orf113 antibody: synthetic peptide directed towards the C terminal of human C6orf113. Synthetic peptide located within the following region: LCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 66 kDa |
| Gene Name | zinc finger with UFM1 specific peptidase domain |
| Database Link | |
| Background | The exact function of C6orf113 remains unknown. |
| Synonyms | C6orf113; dJ412I7.3 |
| Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Mouse: 92%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
