ZNF579 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF579 antibody: synthetic peptide directed towards the middle region of human ZNF579. Synthetic peptide located within the following region: LANIKEEPPSPGTPPQSPPAPPVFLSASCFDSQDHSAFEMEEEEVDSKAH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	zinc finger protein 579
Database Link	NP_689813 Entrez Gene 163033 Human UniProt ID Q8NAF0
Background	ZNF579 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers. ZNF579 may be involved in transcriptional regulation.
Synonyms	FLJ35453
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.