ZNF596 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF596 antibody: synthetic peptide directed towards the C terminal of human ZNF596. Synthetic peptide located within the following region: CGKAFNHSSVLRRHERTHTGEKPYECNICGKAFNRSYNFRLHRRVHTGEK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	zinc finger protein 596
Database Link	NP_775810 Entrez Gene 169270 Human UniProt ID Q8TC21
Background	ZNF596 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Synonyms	FLJ36123
Note	Immunogen Sequence Homology: Human: 100%; Rat: 90%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.