Ehf Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ehf antibody: synthetic peptide directed towards the N terminal of mouse Ehf. Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	ets homologous factor
Database Link	NP_031940 Entrez Gene 26298 HumanEntrez Gene 13661 Mouse UniProt ID O70273
Background	Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter
Synonyms	ESE-3; ESE3; ESE3B; ESEJ; hEHF
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.