PRMT3 Rabbit Polyclonal Antibody

CAT#: TA345674

Rabbit Polyclonal Anti-PRMT3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of protein arginine methyltransferase 3 (PRMT3), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human protein arginine methyltransferase 3 (PRMT3), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human protein arginine methyltransferase 3 (PRMT3), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications 10k-ChIP, WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 60 kDa
Gene Name protein arginine methyltransferase 3
Background Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins.Type I protein arginine N-methyltransferases (PRMTs), such as PRMT3, catalyze the formation of asymmetric N(G),N(G)-dimethylarginine (ADMA) residues in proteins (Tang et al., 1998 [PubMed 9642256]). [supplied by OMIM]. Sequence Note: removed 2 bases from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2630 BC064831.1 3-2632
Synonyms HRMT1L3
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 86%; Rabbit: 86%; Dog: 85%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...