CARS1 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 84 kDa |
Gene Name | cysteinyl-tRNA synthetase |
Database Link | |
Background | CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. CARS gene is one of several loca |
Synonyms | CARS1; CYSRS; cysteine-tRNA ligase; cysteine translase; cysteine tRNA ligase 1; cysteinyl-tRNA synthetase; cytoplasmic; MGC:11246; OTTHUMP00000012605 |
Note | Immunogen Sequence Homology: Human: 100%; Yeast: 82% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Aminoacyl-tRNA biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |