SRP19 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SRP19 antibody: synthetic peptide directed towards the middle region of human SRP19. Synthetic peptide located within the following region: LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	signal recognition particle 19kDa
Database Link	NP_003126 Entrez Gene 6728 Human UniProt ID P09132
Background	SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
Synonyms	signal recognition particle 19kDa
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 92%; Mouse: 92%; Rabbit: 85%; Zebrafish: 77%
Reference Data
Protein Pathways	Protein export

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.