EIF3B Rabbit Polyclonal Antibody

CAT#: TA345851

Rabbit Polyclonal Anti-EIF3S9 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit B (EIF3B), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9. Synthetic peptide located within the following region: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 90 kDa
Gene Name eukaryotic translation initiation factor 3 subunit B
Background EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
Synonyms EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...