RAD51AP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RAD51AP1 antibody: synthetic peptide directed towards the middle region of human RAD51AP1. Synthetic peptide located within the following region: EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	RAD51 associated protein 1
Database Link	NP_006470 Entrez Gene 10635 Human UniProt ID Q96B01
Background	RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.
Synonyms	PIR51
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 92%; Horse: 86%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.