WDR8 (WRAP73) Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-WDR8 antibody: synthetic peptide directed towards the middle region of human WDR8. Synthetic peptide located within the following region: GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | WD repeat containing, antisense to TP73 |
Database Link | |
Background | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. |
Synonyms | WDR8 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |