RAGE (AGER) Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human, Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 36 kDa |
| Gene Name | advanced glycosylation end product-specific receptor |
| Database Link | |
| Background | AGER mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. It is receptor for amyloid beta peptide. |
| Synonyms | RAGE |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Dog: 92%; Guinea pig: 86% |
| Reference Data | |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
