LAMP3 Rabbit Polyclonal Antibody
CAT#: TA346129
Rabbit Polyclonal Anti-LAMP3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-LAMP3 antibody: synthetic peptide directed towards the N terminal of human LAMP3. Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 44 kDa |
| Gene Name | lysosomal associated membrane protein 3 |
| Database Link | |
| Background | LAMP3 might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer. |
| Synonyms | CD208; DC-LAMP; DC LAMP; DCLAMP; LAMP; LAMP-3; TSC403 |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Families | Transmembrane |
| Protein Pathways | Lysosome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
