NAT8B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NAT8B antibody: synthetic peptide directed towards the middle region of human NAT8B. Synthetic peptide located within the following region: SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	N-acetyltransferase 8B (putative, gene/pseudogene)
Database Link	NP_057431 Entrez Gene 51471 Human UniProt ID Q9UHF3
Background	The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance.
Synonyms	CML2; Hcml2; NAT8BP
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Yeast: 83%; Rat: 79%; Mouse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.