GAMT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GAMT antibody: synthetic peptide directed towards the N terminal of human GAMT. Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	guanidinoacetate N-methyltransferase
Database Link	NP_000147 Entrez Gene 2593 Human UniProt ID Q14353
Background	GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals.The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene.
Synonyms	CCDS2; HEL-S-20; PIG2; TP53I2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Mouse: 92%; Bovine: 92%; Rat: 85%; Guinea pig: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Arginine and proline metabolism, Glycine, serine and threonine metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.