BDKRB2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BDKRB2 antibody: synthetic peptide directed towards the N terminal of human BDKRB2. Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	bradykinin receptor B2
Database Link	NP_000614 Entrez Gene 624 Human UniProt ID P30411
Background	BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
Synonyms	B2R; BK-2; BK2; BKR2; BRB2
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 77%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane
Protein Pathways	Calcium signaling pathway, Complement and coagulation cascades, Neuroactive ligand-receptor interaction, Regulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.