ADH6 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | alcohol dehydrogenase 6 (class V) |
Database Link | |
Background | ADH6 is class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. |
Synonyms | ADH-5 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism, Tyrosine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |