CRMP1 Rabbit Polyclonal Antibody
CAT#: TA346284
Rabbit Polyclonal Anti-CRMP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human, Rat, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CRMP1 antibody: synthetic peptide directed towards the N terminal of human CRMP1. Synthetic peptide located within the following region: SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 62 kDa |
Gene Name | collapsin response mediator protein 1 |
Database Link | |
Background | CRMP1 is a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development.This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collapse during neural development. Alternative splicing results in multiple transcript variants. |
Synonyms | CRMP-1; DPYSL1; DRP-1; DRP1; ULIP-3 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 92%; Rabbit: 86%; Zebrafish: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |