DHODH Rabbit Polyclonal Antibody
CAT#: TA346290
Rabbit Polyclonal Anti-DHODH Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 3080.00
CNY 2900.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DHODH antibody: synthetic peptide directed towards the C terminal of human DHODH. Synthetic peptide located within the following region: GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 43 kDa |
Gene Name | dihydroorotate dehydrogenase (quinone) |
Database Link | |
Background | DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Synonyms | DHOdehase; POADS; URA1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 91%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |