Semenogelin I (SEMG1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SEMG1 antibody: synthetic peptide directed towards the middle region of human SEMG1. Synthetic peptide located within the following region: KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	semenogelin I
Database Link	NP_937782 Entrez Gene 6406 Human UniProt ID P04279
Background	SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly
Synonyms	CT103; MGC14719; RATSVPIIA; secretion 2; semenogelin I; SEMG; seminal vesicle protein; seminal vesicle secretory protein 2; SGI; SVPIIA; Svs2; Svs2p2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.