EEF1G Rabbit Polyclonal Antibody

CAT#: TA346547

Rabbit Polyclonal Anti-EEF1G Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4381.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of eukaryotic translation elongation factor 1 gamma (EEF1G)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human eukaryotic translation elongation factor 1 gamma (EEF1G), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human eukaryotic translation elongation factor 1 gamma (EEF1G), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-EEF1G antibody: synthetic peptide directed towards the N terminal of human EEF1G. Synthetic peptide located within the following region: AAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 50 kDa
Gene Name eukaryotic translation elongation factor 1 gamma
Background This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq, Jul 2008]
Synonyms EF1G; GIG35
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...