STK16 Rabbit Polyclonal Antibody
CAT#: TA346579
Rabbit Polyclonal Anti-STK16 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-STK16 antibody: synthetic peptide directed towards the middle region of human STK16. Synthetic peptide located within the following region: TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | serine/threonine kinase 16 |
Database Link | |
Background | STK16 is a protein kinase that acts on both serine and threonine residues. |
Synonyms | FLJ39635; KRCT; MPSK; PKL12; protein kinase expressed in day 12 fetal liver; serine; threonine kinase 16; TSF1 |
Note | Immunogen Sequence Homology: Dog: 100%; Goat: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Horse: 92%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |