TRUB2 Rabbit Polyclonal Antibody
CAT#: TA346619
Rabbit Polyclonal Anti-TRUB2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-TRUB2 antibody: synthetic peptide directed towards the N terminal of human TRUB2. Synthetic peptide located within the following region: MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 37 kDa |
| Gene Name | TruB pseudouridine synthase family member 2 |
| Database Link | |
| Background | Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AK001956.1, AF131848.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## |
| Synonyms | CLONE24922 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
