TRUB2 Rabbit Polyclonal Antibody

CAT#: TA346620

Rabbit Polyclonal Anti-TRUB2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of TruB pseudouridine (psi) synthase homolog 2 (E. coli) (TRUB2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human TruB pseudouridine (psi) synthase homolog 2 (E. coli) (TRUB2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human TruB pseudouridine (psi) synthase homolog 2 (E. coli) (TRUB2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TRUB2 antibody: synthetic peptide directed towards the middle region of human TRUB2. Synthetic peptide located within the following region: MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 37 kDa
Gene Name TruB pseudouridine synthase family member 2
Background Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AK001956.1, AF131848.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END##
Synonyms CLONE24922
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 86%; Rabbit: 86%; Zebrafish: 82%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...