SNAP23 Rabbit Polyclonal Antibody

CAT#: TA346718

Rabbit Polyclonal Anti-SNAP23 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SNAP23 antibody: synthetic peptide directed towards the N terminal of human SNAP23. Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 23 kDa
Gene Name synaptosome associated protein 23kDa
Background Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-associated protein of 25 kDa), form a complex which serves as a binding site for the general membrane fusion machinery. Synaptobrevin/VAMP and syntaxin are believed to be involved in vesicular transport in most, if not all cells, while SNAP25 is present almost exclusively in the brain, suggesting that a ubiquitously expressed homolog of SNAP25 exists to facilitate transport vesicle/target membrane fusion in other tissues. The protein encoded by this gene is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Synonyms HsT17016; SNAP-23; SNAP23A; SNAP23B
Note Immunogen Sequence Homology: Human: 100%; Horse: 92%; Zebrafish: 90%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Yeast: 83%; Bovine: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways SNARE interactions in vesicular transport
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...