NAT13 (NAA50) Rabbit Polyclonal Antibody
CAT#: TA346839
Rabbit Polyclonal Anti-NAT13 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-NAT13 antibody: synthetic peptide directed towards the C terminal of human NAT13. Synthetic peptide located within the following region: AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 19 kDa |
| Gene Name | N(alpha)-acetyltransferase 50, NatE catalytic subunit |
| Database Link | |
| Background | NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity. |
| Synonyms | hNAT5; hSAN; MAK3; NAT5; NAT5P; NAT13; NAT13P; SAN |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
