TKTL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2. Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	transketolase-like 2
Database Link	NP_115512 Entrez Gene 84076 Human UniProt ID Q9H0I9
Background	The function remains unknown.
Synonyms	DKFZp434L1717; FLJ32975
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 86%
Reference Data
Protein Pathways	Metabolic pathways, Pentose phosphate pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.