Transglutaminase 7 (TGM7) Rabbit Polyclonal Antibody

CAT#: TA346859

Rabbit Polyclonal Anti-TGM7 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of transglutaminase 7 (TGM7)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human transglutaminase 7 (TGM7), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human transglutaminase 7 (TGM7), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TGM7 antibody: synthetic peptide directed towards the C terminal of human TGM7. Synthetic peptide located within the following region: TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 80 kDa
Gene Name transglutaminase 7
Background Transglutaminases (TGM; EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks. For additional background information on transglutaminases, see TGM1 (MIM 190195). [supplied by OMIM, Jul 2002]. ##Evidence-Data-START## Transcript exon combination :: AF363393.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025087, ERS025093 [ECO:0000350] ##Evidence-Data-END##
Synonyms TGMZ
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Rat: 92%; Guinea pig: 86%; Mouse: 85%; Horse: 79%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...