ECHDC2 Rabbit Polyclonal Antibody
CAT#: TA346864
Rabbit Polyclonal Anti-ECHDC2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ECHDC2 antibody: synthetic peptide directed towards the middle region of human ECHDC2. Synthetic peptide located within the following region: FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 28 kDa |
| Gene Name | enoyl-CoA hydratase domain containing 2 |
| Database Link | |
| Background | ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown. |
| Synonyms | DKFZp686F0985; DKFZp686K13244; FLJ10948; FLJ45240; FLJ51075; FLJ52213; FLJ52450; FLJ78805 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
