Galectin 7 (LGALS7) Rabbit Polyclonal Antibody

CAT#: TA358636

LGALS7 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of lectin, galactoside-binding, soluble, 7 (LGALS7)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 7 (LGALS7), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 7 (LGALS7), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP
Specificity Expected reactivity: Cow, Dog, Human, Mouse, Pig, Rat
Homology: Cow: 93%; Dog: 79%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Predicted Protein Size 15 kDa
Gene Name galectin 7
Background The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19.
Synonyms Gal-7; GAL7; galectin-7; HKL-14; LGALS7A; PI7; PIG1; TP53I1
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...