Rnf41 (BC019415) Mouse Tagged ORF Clone

CAT#: MG201892

  • TrueORF®

Rnf41 (tGFP-tagged) - Mouse ring finger protein 41 (cDNA clone MGC:30902 IMAGE:4014525)

ORF Plasmid: DDK tGFP



  "BC019415" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2850.00


货期*
4周

规格
    • 10 ug

Product images

推荐一起购买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms 4933415P08Rik, FLRF
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201892 representing BC019415
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCAAAGATGAACTGCCAAACCACAATTGCATTAAGCACCTGCGCTCCGTGGTCCAGCAGCAGCAGT
CGCGCATCGCAGAGCTGGAGAAGACCAGGGCTGAACACAAGCACCAGCTGGCAGAGCAGAAGCGAGACAT
TCAGCTGCTGAAGGCGTATATGCGAGCCATCCGCAGTGTCAACCCCAACCTTCAGAACCTGGAGGAGACA
ATCGAATACAACGAGATCCTCGAGTGGGTGAACTCCCTGCAGCCGGCAAGGGTGACCCGCTGGGGGGGCA
TGATCTCCACTCCTGATGCTGTGCTCCAGGCTGTCATCAAGCGCTCCCTCGTGGAAAGTGGCTGCCCGGC
CTCCATCGTCAACGAGCTGATTGAAAATGCCCATGAACGCAGTTGGCCCCAGGGTCTGGCCACACTAGAG
ACAAGACAGATGAACCGGCGCTACTATGAGAACTACGTGGCCAAGCGCATCCCTGGCAAGCAGGCTGTAG
TGGTGATGGCCTGTGAGAACCAGCACATGGGGGACGACATGGTGCAGGAGCCAGGGCTCGTCATGATATT
TGCGCATGGTGTGGAGGAGATA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201892 representing BC019415
Red=Cloning site Green=Tags(s)

MPKDELPNHNCIKHLRSVVQQQQSRIAELEKTRAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEET
IEYNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLE
TRQMNRRYYENYVAKRIPGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN BC019415
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC019415, AAH19415
RefSeq Size 1739 bp
RefSeq ORF 584 bp
Locus ID 67588
Gene Summary Acts as E3 ubiquitin-protein ligase and regulates the degradation of target proteins. Polyubiquitinates MYD88 (By similarity). Negatively regulates MYD88-dependent production of proinflammatory cytokines. Can promote TRIF-dependent production of type I interferon and inhibits infection with vesicular stomatitis virus. Promotes also activation of TBK1 and IRF3 (PubMed:19483718). Involved in the ubiquitination of erythropoietin (EPO) and interleukin-3 (IL-3) receptors. Thus, through maintaining basal levels of cytokine receptors, RNF41 is involved in the control of hematopoietic progenitor cell differentiation into myeloerythroid lineages (PubMed:18495327). Contributes to the maintenance of steady-state ERBB3 levels by mediating its growth factor-independent degradation. Involved in the degradation of the inhibitor of apoptosis BIRC6 and thus is an important regulator of cell death by promoting apoptosis. Acts also as a PRKN modifier that accelerates its degradation, resulting in a reduction of PRKN activity, influencing the balance of intracellular redox state. The RNF41-PRKN pathway regulates autophagosome-lysosome fusion during late mitophagy. Mitophagy is a selective form of autophagy necessary for mitochondrial quality control (PubMed:24949970).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...