Neil2 (NM_201610) Mouse Tagged ORF Clone
CAT#: MG220912
- TrueORF®
Neil2 (tGFP-tagged) - Mouse nei like 2 (E. coli) (Neil2), (10ug)
ORF Plasmid: DDK
"NM_201610" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 4370.00
Specifications
| Product Data | |
| Type | Mouse Tagged ORF Clone |
| Tag | TurboGFP |
| Synonyms | Gm1212; NEH2 |
| Vector | pCMV6-AC-GFP |
| E. coli Selection | Ampicillin (100 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>MG220912 representing NM_201610
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCAGAAGGGCCATCTGTGAGGAAGTTTCACCATCTTGTCTCCCCCTTTGTGGGCCAGAAGGTGGTCA AGACGGGGGGCAGCAGTAAGAAGCTCCACCCTGCCGCCTTTCAGTCTCTGTGGCTCCAGGATGCTCAGGT GCATGGAAAAAAATTATTCCTTCGGTTTGATCCAGATGAGGAGATGGAGCCACTCAACAGCAGCCCACAG CCTATACAGGGAATGTGGCAGAAAGAGGCTGTGGACCGAGAGCTGGCCTTGGGTCCCAGTGCTCAGGAAC CCTCTGCAGGTCCCTCTGGATCTGGGGAGCCTGTTCCCAGTAGATCTGCTGAAACATATAATCTTGGGAA GATCCCCTCAGCAGATGCCCAGAGGTGGCTGGAGGTCAGGTTTGGTTTATTTGGCAGTATCTGGGTGAAT GACTTCTCCAGAGCAAAGAAAGCTAACAAAAAAGGTGACTGGAGAGACCCAGTGCCCAGGCTGGTACTCC ATTTTAGTGGTGGTGGCTTCCTGGTATTTTATAACTGCCAGATGTCATGGAGCCCTCCCCCAGTGATTGA GCCCACCTGTGACATATTGTCTGAAAAGTTCCATCGAGGACAAGCCTTGGAAGCTCTAAGCCAGGCTCAG CCTGTGTGCTACACACTCTTGGACCAGAGATACTTCTCAGGATTAGGGAACATCATAAAGAATGAAGCCT TGTACAGAGCAAGGATCCATCCCCTCTCTCTCGGTTCATGCCTGAGTTCTTCCTCTCGGGAGGCCCTCGT GGATCACGTGGTGGAGTTCAGTAAGGACTGGCTTCGGGACAAATTCCAAGGCAAGGAACGGCACACACAG ATCTACCAGAAGGAACAATGTCCTTCTGGTCACCAGGTCATGAAGGAGACATTTGGGCCCCCAGATGGGC TCCAGAGGCTCACCTGGTGGTGCCCTCAATGCCAGCCCCAGCTGTCCTCCAAGGGGCCCCAGAATCTCCC GTCCTCC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >MG220912 representing NM_201610
Red=Cloning site Green=Tags(s) MPEGPSVRKFHHLVSPFVGQKVVKTGGSSKKLHPAAFQSLWLQDAQVHGKKLFLRFDPDEEMEPLNSSPQ PIQGMWQKEAVDRELALGPSAQEPSAGPSGSGEPVPSRSAETYNLGKIPSADAQRWLEVRFGLFGSIWVN DFSRAKKANKKGDWRDPVPRLVLHFSGGGFLVFYNCQMSWSPPPVIEPTCDILSEKFHRGQALEALSQAQ PVCYTLLDQRYFSGLGNIIKNEALYRARIHPLSLGSCLSSSSREALVDHVVEFSKDWLRDKFQGKERHTQ IYQKEQCPSGHQVMKETFGPPDGLQRLTWWCPQCQPQLSSKGPQNLPSS TRTRPLE - GFP Tag - V |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NM_201610 |
| ORF Size | 987 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_201610.2, NP_963904.2 |
| RefSeq Size | 1914 bp |
| RefSeq ORF | 990 bp |
| Locus ID | 382913 |
| UniProt ID | Q6R2P8 |
| Gene Summary | Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double-stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| MC214776 | Neil2 (untagged) - Mouse nei like 2 (E. coli) (Neil2), (10ug) |
CNY 3600.00 |
|
| MR220912 | Neil2 (Myc-DDK-tagged) - Mouse nei like 2 (E. coli) (Neil2) |
CNY 3600.00 |
|
| MR220912L3 | Lenti ORF clone of Neil2 (Myc-DDK-tagged) - Mouse nei like 2 (E. coli) (Neil2) |
CNY 5890.00 |
|
| MR220912L4 | Lenti ORF clone of Neil2 (mGFP-tagged) - Mouse nei like 2 (E. coli) (Neil2) |
CNY 5890.00 |
