Cflar (BC023121) Mouse Tagged ORF Clone
CAT#: MR200009
- TrueORF®
Cflar (Myc-DDK-tagged) - Mouse CASP8 and FADD-like apoptosis regulator (cDNA clone MGC:28609 IMAGE:4218551)
ORF Plasmid: tGFP
"BC023121" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1200.00
CNY 2945.00
CNY 6840.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | MRIT, CLARP, FLAME, Casper, I-FLICE, Flip |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200009 representing BC023121
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTCAGTGGGTAAGAGCACCCGACTGCTCTTCCAAAGGTCCAGAGTTCAAATCCCAGCAACCACATG GTGGCTCACAACCATCTGTAACAAGATCTGACTCCCTCTTCTGGAGTGTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200009 representing BC023121
Red=Cloning site Green=Tags(s) MAQWVRAPDCSSKGPEFKSQQPHGGSQPSVTRSDSLFWSV myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | BC023121 |
ORF Size | 120 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC023121 |
RefSeq Size | 2019 bp |
RefSeq ORF | 122 bp |
Locus ID | 12633 |
MW | 74 kDa |
Gene Summary | Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207022 | Cflar (untagged) - Mouse CASP8 and FADD-like apoptosis regulator (cDNA clone MGC:28609 IMAGE:4218551), (10ug) |
CNY 4920.00 |
|
MG200009 | Cflar (tGFP-tagged) - Mouse CASP8 and FADD-like apoptosis regulator (cDNA clone MGC:28609 IMAGE:4218551) |
CNY 2850.00 |
|
MR200009L3 | Lenti ORF clone of Cflar (Myc-DDK-tagged) - Mouse CASP8 and FADD-like apoptosis regulator (cDNA clone MGC:28609 IMAGE:4218551) |
CNY 3600.00 |
|
MR200009L4 | Lenti ORF clone of Cflar (mGFP-tagged) - Mouse CASP8 and FADD-like apoptosis regulator (cDNA clone MGC:28609 IMAGE:4218551) |
CNY 4750.00 |