Nrg4 (BC034839) Mouse Tagged ORF Clone
CAT#: MR200141
- TrueORF®
Nrg4 (Myc-DDK-tagged) - Mouse neuregulin 4 (cDNA clone MGC:40998 IMAGE:3372942)
ORF Plasmid: tGFP
"BC034839" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1800.00
CNY 6840.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AI552600 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200141 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCAACAGATCACGAGCAGCCCTGTGGTCCCAGGCACAGGTCATTTTGCCTCAATGGGGGGATTTGTT ATGTGATCCCTACTATCCCCAGCCCATTCTGTAGGTTTTATCATTTGTTTCTAAGACATTGCCTACTTAA ACCATTCGTGCAATTGGGCACCTTGGTGTACCCAGTGTTTCTGAAGGAGTTTATTCCATTGACGCGCCCC AAGTTCTCATGCAGTGTGTTCCTGAATGCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200141 protein sequence
Red=Cloning site Green=Tags(s) MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRFYHLFLRHCLLKPFVQLGTLVYPVFLKEFIPLTRP KFSCSVFLNA myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | BC034839 |
ORF Size | 240 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC034839, AAH34839 |
RefSeq Size | 1165 bp |
RefSeq ORF | 242 bp |
Locus ID | 83961 |
MW | 9.3 kDa |
Gene Summary | Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206964 | Nrg4 (untagged) - Mouse neuregulin 4 (cDNA clone MGC:40998 IMAGE:3372942), (10ug) |
CNY 1920.00 |
|
MG200141 | Nrg4 (tGFP-tagged) - Mouse neuregulin 4 (cDNA clone MGC:40998 IMAGE:3372942) |
CNY 3400.00 |
|
MR200141L3 | Lenti ORF clone of Nrg4 (Myc-DDK-tagged) - Mouse neuregulin 4 (cDNA clone MGC:40998 IMAGE:3372942) |
CNY 5890.00 |
|
MR200141L4 | Lenti ORF clone of Nrg4 (mGFP-tagged) - Mouse neuregulin 4 (cDNA clone MGC:40998 IMAGE:3372942) |
CNY 5890.00 |