Hbxip (BC028547) Mouse Tagged ORF Clone
CAT#: MR200230
- TrueORF®
Hbxip (Myc-DDK-tagged) - Mouse hepatitis B virus x interacting protein (cDNA clone MGC:41446 IMAGE:1513442)
ORF Plasmid: tGFP
"BC028547" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1200.00
CNY 2945.00
CNY 6840.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 1110003H18Rik; Hbxip; XIP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200230 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGGCGACTTTGGAGCAGCATTTGGAGGACACAATGAAGAATCCATCCATTGTTGGAGTCCTATGCA CAGATTCACAAGGACTTAATCTGGGCTGCCGTGGTACCCTGTCGGATGAGCACGCTGGAGTCATATCTGT TCTAGCCCAGCAGGCAGCTAGGCTAACCTCTGACCCCACCGACATCCCTGTGGTATGTTTAGAATCAGAT AATGGGAACATTATGATCCAGAAACACGATGGCATCACAGTGGCTGTGCACAAAATGGCCTCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200230 protein sequence
Red=Cloning site Green=Tags(s) MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAARLTSDPTDIPVVCLESD NGNIMIQKHDGITVAVHKMAS myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | BC028547 |
ORF Size | 273 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC028547, AAH28547 |
RefSeq Size | 735 bp |
RefSeq ORF | 275 bp |
Locus ID | 68576 |
MW | 9.6 kDa |
Gene Summary | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206925 | Hbxip (untagged) - Mouse hepatitis B virus x interacting protein (cDNA clone MGC:41446 IMAGE:1513442), (10ug) |
CNY 3230.00 |
|
MG200230 | Hbxip (tGFP-tagged) - Mouse hepatitis B virus x interacting protein (cDNA clone MGC:41446 IMAGE:1513442) |
CNY 2850.00 |
|
MR200230L3 | Lenti ORF clone of Hbxip (Myc-DDK-tagged) - Mouse hepatitis B virus x interacting protein (cDNA clone MGC:41446 IMAGE:1513442) |
CNY 4750.00 |
|
MR200230L4 | Lenti ORF clone of Hbxip (mGFP-tagged) - Mouse hepatitis B virus x interacting protein (cDNA clone MGC:41446 IMAGE:1513442) |
CNY 4750.00 |