Rpl10a (BC006039) Mouse Tagged ORF Clone
CAT#: MR200782
- TrueORF®
Rpl10a (Myc-DDK-tagged) - Mouse ribosomal protein L10A (cDNA clone MGC:7602 IMAGE:3494193)
ORF Plasmid: tGFP
"BC006039" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1800.00
| Cited in 1 publication. |
CNY 300.00
CNY 6840.00
Specifications
| Product Data | |
| Type | Mouse Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | CsA-19; Nedd6 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>MR200782 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACATCGAGGCGCTCAAGAAGCTTAACAAGAACAAGAAGTTGGTCAAGAAGCTGGCCAAGAAGTACG ATGCCTTTTTGGCCTCTGAGTCTCTGATTAAGCAGATCCCACGTATCCTGGGCCCAGGCCTAAACAAGGC TGGCAAGTTCCCCTCCCTGCTGACACACAATGAAAACATGGTGGCCAAAGTGGATGAGGTGAAATCGACA ATCAAGTTCCAGATGAAGAAGGTGCTGTGTTTGGCCGTCGCTGTTGGCCACGTGAAGATGACCGATGATG AGCTAGTCTACAACATTCATCTGGCTGTCAATTTCTTGGTGTCCTTGCTTAAGAAAAACTGGCAAAACGT GCGGGCTCTGTACATCAAGAGCACCATGGGCAAGCCCCAGCGTCTGTAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200782 protein sequence
Red=Cloning site Green=Tags(s) MDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKST IKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY myc-FLAG tag |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | BC006039 |
| ORF Size | 399 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | BC006039, AAH06039 |
| RefSeq Size | 1064 bp |
| RefSeq ORF | 401 bp |
| Locus ID | 19896 |
| MW | 15.1 kDa |
Citations (1)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
The Diabetes Gene JAZF1 Is Essential for the Homeostatic Control of Ribosome Biogenesis and Function in Metabolic Stress
,Kobiita, A;Godbersen, S;Araldi, E;Ghoshdastider, U;Schmid, MW;Spinas, G;Moch, H;Stoffel, M;,
Cell Rep
,PubMed ID 32640216
[RPL10A]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| MC200627 | Rpl10a (untagged) - Mouse ribosomal protein L10A (cDNA clone MGC:7602 IMAGE:3494193), (10ug) |
CNY 1800.00 |
|
| MG200782 | Rpl10a (tGFP-tagged) - Mouse ribosomal protein L10A (cDNA clone MGC:7602 IMAGE:3494193) |
CNY 4370.00 |
|
| MR200782L3 | Lenti ORF clone of Rpl10a (Myc-DDK-tagged) - Mouse ribosomal protein L10A (cDNA clone MGC:7602 IMAGE:3494193) |
CNY 5890.00 |
|
| MR200782L4 | Lenti ORF clone of Rpl10a (mGFP-tagged) - Mouse ribosomal protein L10A (cDNA clone MGC:7602 IMAGE:3494193) |
CNY 5890.00 |
