Ing5 (BC064674) Mouse Tagged ORF Clone

CAT#: MR201124

  • TrueORF®

Ing5 (Myc-DDK-tagged) - Mouse inhibitor of growth family, member 5 (cDNA clone MGC:66742 IMAGE:6400183)

ORF Plasmid: DDK tGFP



  "BC064674" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1200.00

CNY 2945.00


货期*
现货

规格
    • 10 ug

Product images

推荐一起购买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
    • 5 ml

CNY 6840.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1700001C14Rik; 1700027H23Rik; 1810018M11Rik; AI225768
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201124 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGACCTACGAGATGGTGGATAAACACATCCGAAGACTTGATGCTGACCTGGCGCGCTTTGAGGCTG
ACCTGAAGGACAGGATGGATGGAAGTGACTTTGAGAGCACTGGAGCACGGAGCTTGAAAAAAGGCCGGAG
TCAGAAAGAAAAAAGAAGCTCCCGGGGCCGAGGCCGGCGGACGTCAGAAGAGGATACCCCAAAGAAGAAG
AAACATAAAAGCGGGTCTGAGTTTACTGACAGTATCCTATCTGTGCACCCCTCTGATGTGCTGGACATGC
CTGTGGATCCGAATGAGCCTACATACTGCTTGTGCCACCAGGTGTCCTACGGGGAGATGATCGGCTGTGA
CAATCCAGATTGTCCCATTGAGTGGTTTCACTTTGCCTGCGTGGATCTCACCACAAAGCCCAAAGGAAAG
TGGTTTTGTCCACGATGTGTTCAGGAAAAGAGGAAGAAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201124 protein sequence
Red=Cloning site Green=Tags(s)

MQTYEMVDKHIRRLDADLARFEADLKDRMDGSDFESTGARSLKKGRSQKEKRSSRGRGRRTSEEDTPKKK
KHKSGSEFTDSILSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGK
WFCPRCVQEKRKKK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN BC064674
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC064674, AAH64674
RefSeq Size 4579 bp
RefSeq ORF 464 bp
Locus ID 66262
MW 17.8 kDa
Gene Summary Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May function as a transcriptional coactivator for RUNX2. Inhibits cell growth, induces a delay in S-phase progression and enhances Fas-induced apoptosis in an INCA1-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...